I am Dr. Leonard Horowitz, responding to this series of allegations that reference me, my credentials, and my positions regarding the H1N1 swine flu “triple reassortant” pandemic.

 

With all due respect, without reading this blog, simply responding to one limited Niman letter I was sent, I replied to radio talk show host Steve Martin’s appeal to "debate" Dr. Niman and his mention of my celebrity this way:

 

“It seems to me that Dr. Niman's observations are honest and accurate. He tells you what he knows and what he does not know. I do not perceive that what he is saying rules out foul play. He is not an epidemiologist, but to my knowledge a molecular biologist and geneticist. He is unable to explain how two S. Calif. children who never met, living 100 miles apart, could simultaneously be the first victims of “triple reassortment“ of the world’s most feared influenza strains. Nor is he able to reconcile how Mexicans living near Mexico City, who had never seen these children, simultaneously got the same never-before-seen triple recombinant infection.”

 

Then I was instructed by Steve Martin to read Dr. Niman’s and colleagues statements that indignantly referred to me as a “dentist” turned “conspiracy theorist.” 

 

Frankly, Ockham's razor analysis would simply contend that if the current official history of this 2009 viral “reassortant” is accurate, then either: 1) God or nature has demonstrated spontaneous combustion in viral creationism synchronously in two American continents; or 2) the vaccin-o-haulics are repeating what they apparently got away with in 1976 and 1977 loosing a “laboratory sourced” viral outbreak for profit and depopulation. (See: Zimmer and Burke, New England Journal of Medicine; July 16, 2009;Vol.361:279-285)

 

Now Dr. Niman is neither naïve or stupid, as those assassinating my credentials as a natural health products pioneer, a retired dentist, and practicing naturopathic physician with extensive virology study, demonstrate by their aversion to material facts proving pharmaceutical iatrogenocide is ongoing in America this flu season.

 

Perhaps Dr. Niman or my detractors might comment on two World Health Organization viral genetics/influenza chiefs, Drs. James Robertson and John Wood, explaining in 2006 that when a serious flu pandemic is predicted, they prefer to loose “primer” viruses into populations in advance. These reverse engineered viruses used to “prime” the public in advance are reverse (genetically) engineered, according to the science detailed by Dr. Robertson in his many publications. Does Dr. Niman contend that these genetic laboratory recombinants remain secure in this age of industrial bioterrorism and white collar crime?

 

Dr. Niman has no explanation for the “accident” that occurred earlier this year--how H5N1 avian flu virions somehow escaped into vaccine vials from a Biocontainment Level-3 facility at the Baxter drug company contaminating Europe's seasonal flu vaccine shipped to more than a dozen locations.

 

Does Dr. Niman and/or my detractors have any medical sociology training? Have they read the scientific publications of Steven Kunitz in APHA journal; studied the evolution of health care in America, cancer research, and public health in the USA; or read any of my national bestsellers, to realize the power wielded by the Rockefeller family and currently George Soros over the genetics/eugenics biotechnology industry?

 

Surely Dr. Niman, whose website alleges his "paradigm shifting" contributions to vaccinology would not wish to bite the hand that feeds him, or he hopes will feed him, by assailing vaccinations as genocidal intoxications, as I freely do.

 

Does Dr. Niman contend it was simply negligence that Baxter, Bayer, and the American Red Cross spread contaminated blood products to the world, largely responsible for AIDS, hepatitis B, Hep. C, and herpes virus pandemics?

 

Would Dr. Niman like to advance his professional opinion regarding SV40’s presence in Merck’s VERO cell cultures used in the early polio vaccines, and currently used by the Baxter corporation that is responsible for flu vaccine safety across Europe this year after “accidentally” shipping H5N1-laced flu vaccines throughout Eurasia?

 

Does Dr. Niman think it is more or less likely triple viral "reassortants" occurred recently by nature or lab “accident” combining Asian avian, Mexican pig, and the Spanish flu virus extinct since 1918 until resurrected this decade by pedigreed pharmaceutical prostitutes called virologists?

 

Gee wiz. Sorry. I just lost my CULTured composure.

 

My blood boils when I consider the astonishing ignorance of those who call themselves intelligent credentialed “scientists”—hypocrites who license and promote poisons, condemn natural remedies, and accomplice gross criminal official malfeasance in the administration of vaccination policies that advance genocide under the guise of public health. 

 

Like I wrote to the FBI the other day, read "The AFFIDAVIT" I presented to the world evidenced by 23 freely downloadable EXHIBITS. Then tell me you are doing your best to protect Americans and future generations. (See: FLUscam.com "The AFFIDAVIT" page.)

 

Best wishes,

 

Dr. Leonard G. Horowitz

 

 

Dr. Niman wrote, responding to talk show radio host Steve Martin, on Thu Oct 01, 2009 11:14 am:

 

No, there is NO 1918 virus in the pandemic strain. The 2009 pandemic strain is from triple reassortant swine viruses that are currently circulating. It is ALL natural. [Emphasis added by editor. See: Dr. Niman’s contradicting clarification on Sun Oct 04, 2009 2:58 pm]

 

The 1918 sequences are known. That virus has changes that trace to human H1N1 and swine H1N1 ciculating in the 1930's (swine is A/swine/Iowa/30 and human is A/WSN33). The swine from Iowa is classical swine. This has NOTHING to do with the 2009 pandemic strain.

 

The paper you cited is a structural anlysis done by Ian Wilson's lab at Scripps. We collaborated when I was at Scripps and published papers together:

 

Generation of protein-reactive antibodies by short peptides is an event of high frequency: implications for the structural basis of immune recognition.

 

Niman HL, Houghten RA, Walker LE, Reisfeld RA, Wilson IA, Hogle JM, Lerner RA.

 

Proc Natl Acad Sci U S A. 1983 Aug;80(16):4949-53.

 

 

Dr. Niman replied to radio talk show host, Steve Martin, on Thu Oct 01, 2009 11:40 am.

 

I really don't follow the internet babble very closely because it is so absurd. Jeff Rense occasionally e-mails me stories and I just roll my eyes. Its not that the story have a debatable controversial issue, its that they are absurd. Your comment above is one example. The 2009 virus is quite natural and doesn't have segments of the 1918 virus. There may be a few polymorphisms because 1918 is a recombinant between swine H1N1 and human H1N1 from the 1930's, and swine can hold onto some small segemnts and swap them through recombination, but there is NO data supporting placing of these polymorphisms in the 2009 pandemic sequence. which is a swine triple reassortant.

 

These stories really lack specifics and make absolutely absurd assumptions. Many pharmas are working on H5N1 vaccines. Like the swine 2009 vaccine, viruses are distributed by WHO regional centers and vaccine makers use the H and N as targets. These sequences are PUBLIC.

 

There was an internet story about the tragets being bioweapons crreated by some mystery group planning on unleasing the pandemic strain as part of a population control program. The evidence for the existance of the "secret" bioweapons was the fact that vaccine makers had a target so they must have made a secret bioweapon, when the reality is that the targets are the H5N1 isolates from dead patients that are well know and the sequences are PUBLIC.

 

 

Dr. Niman replied to radio talk show host, Steve Martin, on: Thu Oct 01, 2009 12:15 pm

 

I am going to have to break, but here is the real deal on the pandemic vaccine. Vaccine safety is definitely NOT my area of expertise, but the pandemic vaccine is a NO BRAINER. It is made the same way as the seasonal flu vaccine, but has ONE target instead of THREE. It is constructed the same way as new targtets are constructed almost EVERY YEAR by vaccine companies. It has the same six carrier genes with H and N targets added. For the pandemic vaccine, the H and N come from one of the first cases in southern California. The child had a mild case and the target was identified in April (A/California/7/2009). Like the seasonal flu, the virus is grow in eggs, purified, and killed. There is NO adjuvent and the US govenment has bought 250 million doses. It is FREE (although some Drs or retailers may change an administrative fee of something like $10-$25).

 

The seasonal flu has been made this way for years. You can walk into a Walgreens drug store and get the seasonal flu shot today. In Pittsburgh you can get a shot at the SUPERMARKET!

 

The virus is DEAD. The vaccine is used in RETIREMENT homes in people that are 80 and 90 years old with SEROIUS chronic medical problems. It is given to children and pregnant women. It cost $20-$25 and is NO big deal!

 

I get a shot every year and have had NO ill effects. I have six children who have received the shot with NO ill effects. The first time the youngest got the shot (she was under 10), she got TWO shots, three weeks apart. There was NO problem. There also has been NO real controversy on the safety front. Some may argue that it works better in healthy children and adults than those over 65 who are most vulnerable, but no one is saying that the vaccine is creating serious adverse effects.

 

I am not an MD and am not directing anyone to get a seasonal or pandemic flu shot, but I haven't seen any good reason for not (other than those who have egg allergies or have some issue that precludes getting a seasonal flu shot), internet babble nothwithstanding.

 

The pandemic vaccine is a NO BRAINER. The internet babble is utter nonsense and a sad commentary on the level of logic and rationale thought in the general population.

 

It is an example of MASS HYSTERIA, that will be studied for years to come (and those looking at the history will just shake their head and say how could so many people be so stupid as to believe that the vaccine was part of a government conspiracy on population control or an untested product with serious risk).

 

 

Dr. Niman wrote regarding the use of Navy personnel in secret vaccine trials on Thu Oct 01, 2009 6:26 pm:

 

. . . . Here's my thing... Back in April/May there was a lot more concern/fear that we may be facing a 1918-like global pandemic, remember. If I were in a position of great responsiblity and authority, being advised that such a pandemic could claim a great many fatalities in my own country, and there was a new vaccine (nasal; live virus) which hadn't yet been tested but which could be the answer and needed to be tested... what would I do?

I'd got to get it tested on someone, right? First to come to mind is a prison population. Then realizing that prisoners get visitors, and correctional officers are themselves not incarcerated, they get to go to their homes and neighborhoods, so the prison itself cannot be quarantined... Who else to test on?... Why not a few hundred sailors who are off the continent at sea, receiving no visitors for a few months?

Yes that sounds Macheavellian (sp?)...but pragmatic?...considering the fear and concern?... possible?

 

 

Dr. Niman wrote, responding to talk show radio host Steve Martin, on Fri Oct 02, 2009 3:46 am:

 

I have received a number of safety / efficacy questions on the vaccine, and many sub-topics on this thread originate in conspiracy sites, which exist in a parallel universe which lacks a reality base. Although vaccine composition / regulatory issues are NOT my area of expertise, I can offer a few relevant points to put the vaccine issues into an analysis framework that has a reality base.

 

Vaccines in general go through the same types of clinical trials as other drugs. Companies first generate pre-clinical data from lab experiments and animal testing. When a drug passed those preclinical tests it then goes into a clinical phase, which requires approval (IND based on animal data). Clinical trials start with safety and for a vaccine this would typically involve healthy adults. If there are no significant adverse effects, the trial will expand to larger numbers and vary the dose to identify the appropriate dose for a larger trial. The company then has to provide data showing that the drug is both safe and efficacious.

 

For the flu vaccines in the US, the pandemic vaccine testing is really just a formality because it is really the FDA approved seasonal vaccine with a new target. The FDA approved seasonal flu vaccine is based on the assumption that the flu target will change and the new targets will be used. Thus, a new clinical trial is not required each time the target changes, in part becasue there really isn't enough time because new targets are selected every six months, and the "drug" is really the same (the virus is grown under the FDA approved method and has the FDA approved components, which includes the carrier virus). Thus, the pandemic vaccine does NOT contain a new virus, it just has 2 of the 8 gene segments of the new virus, which is what is done each time a new vaccine is made (the old H and N are swapped for the new H and N).

 

The seasonal flu vaccine has been used for years, and the established safety profile allows for use WITHOUT a prescription. Many areas offer the shot a flu clinics set up a drug stores or super markets. The vaccine is safer than an infection, because the virus is killed. Thus, the shot for the pandemic strain has the same carrier, a virus isolated in 1934 in Puerto Rico (PR-8). In the seasonal flu there are THREE different targets, the PR-8 virus with H and N from human H1N1, H3N2 and influenza B. This year the pandemic vaccine just has one target - PR-8 with the H and N from swine H1N1. Next year the swine H1N1 will replace the seasonal H1N1, so it actually will be in the seasonal flu shot. The virus is grown in chicken eggs, harvested, and killed.

 

The VAST majority of immunized people in the US will get a shot of a killed, split vaccine made as described above. The nasal spray, which is the other vaccine purchased by the US uses a cold adapted carrier (a virus isolate in Michigan in 1980), which grows at room temperature, but is severly weakened at body temperature because of multiple genes that don't function well at higher temperatures. That vaccine has 6 cold adapted genes and new H and N targets.

 

Other vaccines are under development. These include viruses grown in mammalian cells, other targets such as DNA, and use of adjuvents, some of which are proprietory and some of which have been used for decades in other vaccines and are generic. However, all of these newer versions have to go through clinical trials, which will be more vigorous becasue the track record is shorter, especially in the US.

 

The clinical trials for the pandemic vaccine produced data which was MUCH better than expected. One shot of the lower dose produced protective antibody levels in more than 90% of volunteers. Test was done sequentially. First trail was with healthy adults. Since there were no significant adverse effects, a trail with children was started and when there still were no adverse effects, a trial with pregnant women began.

 

The idea that clandestine trials were required is nonsense. The pandemic vaccine really isn't new, and the rate limiting step is NOT initial results from a trial. It is growing the vaccine in quantity.

 

 

Dr. Horowitz posted the following on Sat Oct 03, 2009 8:56 pm:

 

First I wish to thank Dr. Henry Niman for responding to third party requests, as I have, to discuss these matters of extreme urgency as millions of lives may be impacted by our discussions herein.

 

Like Dr. Niman, who writes that he tends “to stay focused in [his] areas of expertise . . . the genetic composition of the pandemic H1N1,” I tend to stay focused on my areas of expertise that include medical sociology and behavioral science, and the geopolitical correlates and antecedents of genocide using emerging diseases. With this “focus” I seek, and commonly find, dishonesty in the vaccine industry and federal agencies. Thus, I pray this discussion from different perspectives will be enlightening and beneficial to extinguish certain myths, including those in my analysis that Dr. Niman views as glaringly ignorant.

 

 

DISCLOSURE

 

As a declaration of conflicting interests, many of the organizations and institutions mentioned below advancing “biopreparedness” and flu vaccines favor Dr. Niman’s services. Recombinomics, according to his many patents, represents a lucrative technology that he values, as do  vaccine advocates and manufacturers. This bias endorses the allopathic paradigm exclusively.

 

Alternatively, I am financially rewarded by my endorsement of OxySilver that competes directly with vaccines and antibiotics. Serious investigation of this covalently-bonded silver hydrosol enhanced by 528Hz hydrosonics explains why the foundation of allopathic medicine and vaccinology is threatened by my revelations here and elsewhere.

 

So people reading this dialogue should be informed that conflicting interests contaminate our views—Dr. Niman favors vaccinations and defends the industry prospering him, and I favor and am prospered by the aforementioned heavily suppressed alternative technology.

 

 

KEY SCIENCE: WHAT IS “NATURAL”

 

To begin, Dr. Niman, you write, “the genetic composition of the pandemic H1N1 has been used to claim that it is man made (deliberate or lab escape) . . . nothing could be further from the truth . . . comments about triple reasortants not being natural reveal a rather glaring lack of knowledge about information well established in the scientific literature.”

 

Assuming I am as ignorant as many of our lay readers, Dr. Niman, please tell me/us, genetically-speaking, in terms everyone can understand, is there any difference between two H1N1 avian/swine recombinant virus clones containing all eight genetic sequences evidencing a “triple reassortant” found in “nature,” such as the one you have identified currently spreading called “influenza A (H1N1) virus” or “S-OIV,” and the same isolate analyzed in your lab?

 

In other words, given sophisticated gene sequencing analysis, is there any difference between two cloned viruses, one present in a lab, and the other in a pig, human, or bird moving about this planet?

 

As far as I know, NO, there is no difference that you can tell, despite the sophistication of your technology.

 

This is not to degrade your ability to show differences, track virus evolution, or speculate intelligently about recombination probabilities, but this question and correct answer seems especially relevant because throughout the past century much, possibly most, of the viral reassortments/recombinants studied in science were accomplished by labs using live animals (i.e., in vivo) rather than in cell cultures (i.e., in vitro).

 

Thus, your assertion that this triple H1N1 reassortment is certifiably “natural,” to me is specious.

 

Given my “focus,” such attitudes reflect more wishful thinking. In your community there is general incredulity that spreading germs might have been “seeded” by pharmaceutical agents and federal agencies profiting from plague frights and vaccine programs, as I will attempt to convince you and our readers here.

 

As World Health Organization documents reveal, vaccine makers receive their viruses, otherwise called “biosimilars,” or “mock up files,” from Dr. James Robertson et al. serving the WHO, CDC, and beyond to the various vaccine makers that engage your common industry and allopathic paradigm. In this instance of pandemic flu, these transfers are derived in whole or part from the “triple reassortant” you have analyzed and others have named “S-OIV.” 

 

Where nature stops and labs begin nobody really knows, and recombinomics analysis is little help in this important regard as it can neither diagnose, predict, or retrospectively pinpoint the source of a laboratory loosed virus composed of sequences naturally circulating. 

 

For example, if an agent with access to Dr. Robertson’s lab, or the CDC’s supply, loosed the circulating triple reassortant, S-OIV, where would you be? You write repeatedly these gene sequences have undergone reassortments and switchings for more than a century. So, providing your lab was supplied with a clone of the culprit bearing identical sequences as S-OIV, you have no way of certifying the virus’s origin, and would be hard pressed to determine what came first, the lab clone, the avian, pig, or human contribution.

 

Comparative analyses might be helpful, as in the recent publication by Zimmer and Burke, but there is much left to faith and discernment.

 

Said another way, and please correct me if I am wrong, recombinomics cannot certify the “source” or origin of a cloned triple recombinant, or any cloned viruses produced in vivo or in vitro, accidentally or intentionally released into the wild, including those released into the “wild” via vaccines.

 

So most disconcerting is your claim with perceived authority that you know absolutely S-OIV came from “nature” and not a lab. I believe you are exaggerating your certainty which is undermining your credibility in my mind.

 

If there is foul play (i.e., vaccine genocide) happening here,  recombinomics, and your “focused” analyses, would not only miss it, your life’s work would be used to aid and abet it given your alliances with special interests.

 

I have reviewed, thanks to your direction, a couple of your referenced writings. My concern about your referencing reassortants from the 1990s as alleged proof that this flu came from God or “nature,” or a chance transmission between avain, swine and man, not by MI6 direction through the CIA (that according to the Washington Post and federal documents oversees all infectious disease agencies in the UK and America respectively, and is controlled by the same Rockefeller family interests that have controlled American medicine and public health since its inception) is that by the 1990s the world’s most horrific recombinants had already been created in bioweapons labs worldwide as published in the Special Virus Cancer Program (SVCP) report by the National Cancer Institute.

 

For example, the NCI’s SVCP publications that you can read, like I did, prove that several of the influenza sequences you analyze today were apparently recombined with acute lymphocytic leukemia viruses by the early 1970s using animals as crude incubators and recombination chambers. New “virus material” was then tested in sprayed aerosols for lethality, and by injections. These agents were developed to transmit fast acting cancers by inoculations or sneezing, AND were reasoned to be legitimate “cancer research” aimed at developing vaccines to cure cancers.

 

 

CORRECTIONS APPRECIATED

 

Frankly, I appreciate your correction that my claim is false that the current circulating flu contains genes from H5N1, not simply avian H1N1. But, in fact, it was not me that first issued this insinuation. It was Thomas Glocer’s Reuters News Service that initially alerted the world (on April 23, 2009) that this new flu was identified, and referenced H5N1 as highly feared in it.

 

Working in the industry, you probably know what most people do not--that Thomas Glocer also directs the Merck pharmaceutical company on its board of directors. Thus, this propaganda is important to discern. This news release was immediately preceded by others heralding the CDC/Novavax preclinical trails of their vaccine that allegedly provided immunity against H5N1 and H1N1 strains. I found this to be more than synchronous given Novartis’s advancing acquisition of Novavax at the prime time the fright and market for this vaccine was generated. Plus, this kind of profitable propaganda issuing from vaccine makers this spring and summer is everywhere. Here is Glaxo-SmithKlein’s recent H1N1-H5N1 paired propaganda:

 

“Following more than ten years of investment in research and development of pandemic influenza vaccines, and the successful registration of its pre-pandemic H5N1 vaccine, the company is making rapid progress to produce an A (H1N1) adjuvanted influenza vaccine.”

 

Likewise, H5N1 and adjuvanted vaccines are heralded widely by industry promotions pertaining to the current pandemic.

 

So with my focus on medical sociology, behavioral science, and media persuasion for mass marketing of emerging diseases and vaccines and drugs to treat them, I see clearly the agenda of pushing H5N1 fears and vaccines. I am also aware that H5N1 is said to be circulating globally, and authorities are most threatened by a recombination involving this agent and the spreading S-OIV.

 

Consequently, I view the media as providing constant clues as to what is actually happening geopolitically and economically bearing on the worlds of science and medicine, but I no longer trust ANYTHING I am reading in mainstream media, or drug industry propaganda, due to underlying financial and geopolitical agendas.

 

 

CHALLENGING BASIC TENETS

 

Dr. Niman, you wrote in your referenced paper that your technologies and observations, “challenge the basic tenets of influenza genetics and provide a method for predicting the

changes in seasonal and pandemic influenza, as well as other rapidly evolving genomes.”

 

Despite this potentially practical capability, just as you were unable to predict Baxter corporation’s H5N1 viral “accident” that contaminated vaccines shipped across Europe in early 2009, you would not be able to predict a similar “accident” occurring tomorrow risking the public’s health through the vaccines you endorse.

 

You wrote, “recombination plays an important role in influenza evolution and can generate both drifts and shifts in a predictable manner.” Can you, therefore, predict what

“natural” versus “laboratory sourced” pandemics might be expected from the current flu vaccines “seeding” populations worldwide with “active” genetic sequences from viral particles included in vaccines you recommend? What potential is there for these active sequences to recombine with H5N1 also circulating? Or with other viruses, including cancer viruses such as Epstein Barr, or hemorrhagic fever viruses?  

 

You wrote on your website about an incident involving a Marburg virus outbreak in Angola. You wrote this bizarre “seeding” was reportedly “initiated via a childhood vaccine program.”

 

So we are at risk of having “accidental” and “intentional” vaccine contaminations and transmissions, as historically certified, that preclude your ability to claim with any certainty that this 2009 pandemic reassortant did not follow similarly from vaccine exposures of flu recombinants administered to people worldwide over the past several decades, or foul play by drug industrialists in April 2009, but also you infer a risky “natural” recombination possibility given Asian avian, Mexican pig and 1918 human “Spanish flu” sequences administered in the 2009 vaccines may potentially recombine with circulating viruses.

 

There is one anecdotal report from a frightened woman who testified on YouTube regarding a nurse who explained that the initial Mexican outbreak was associated with a vaccine experiment. (See: FLUscam.com “Media Central”) Surely this is a possibility, I believe high probability, especially in light of a growing body of circumstantial evidence investigative journalist Sherri Kane and I have been unearthing.

 

 

EARLIER SIMILAR CATASTROPHIES

 

Another vaccine-related catastrophe involves your field of expertise in molecular biology developed during the 1970s. Your “dissertation focused on feline retroviral expression in tumors in domestic cats,” according to your website. So you must be familiar with George Todaro’s pioneering work in this field. Todaro reported that feline leukemia was another man-made virus that apparently evolved during cancer virus hybridization and/or vaccine studies. This was the case, Todaro reported, for the RD114 cat/human mutant. Vaccine experiments involved cross species transfers of infectious particles. Among these was the “KT [Kawakami-Theilen] strain of feline leukemia virus (FLV) concentrated to 103 virus particles/ml” according to a 1971 Merck & Co. contract with the NCI. (See page 268 of Death in the Air: Globalism, Terrorism, and Toxic Warfare, by Horowitz, June, 2001.) Are you able to acquire RD 114, the KT-FLV, and contemporary strains of feline leukemia, to retrospectively determine whether the genetic segments of the feline leukemia pandemic today sources, as Todaro reported, from the KT laboratory experiments? This may be valuable in further evidencing the man-made origin of HIV-AIDS as well.

 

As you may recall, Dr. Don Francis and the entire HTLV-III/HIV-1 AIDS-investigating community strongly suspected this FLV agent was linked to the origin of AIDS from Merck’s hepatitis B vaccines prepared in Litton supplied chimpanzees. Few dared comment on it, however, lest they lose their valued positions within the genetic academic community. Are you in more or less the same position?

 

If you have the ability to secure certified original samples of the chimpanzee cultured hepatitis B strains inoculated into gay men in NYC and Willowbrook State School mentally retarded children on Staten Island between 1972 and 1974, and compare viral sequences present in this vaccines with SIVcpz, I will wager $15,000 right now you will find stunning smoking gun evidence of the presence of SIVcpz indicating genocidal malfeasance in this vaccine study triggered HIV/AIDS in the US and Africa. As Gerald Myers, working for Los Alamos wrote, “The preponderance of evidence still argues for an explosive event in the mid-1970s” giving rise to HIV-1 subtypes A-F.

 

This Merck vaccine trial was actually part of the SVCP research being completed at the time you were just finalizing your dissertation on this subject, so you must be familiar with Dr. Francis’s published observations in this regard, and probably Dr. Todaro’s thesis on cross-species recombinants between retroviruses investigated to transmit chicken sarcoma, feline leukemia, and human AIDS-like illnesses. Dr. Francis heralded these concerns to reporter Randy Shiltz. Francis linked HTLV-III/HIV-1 (AIDS) to hepatitis B and feline leukemia.

 

Although this “entrepreneurial dentist” knows less than you regarding recombinomics, I know a good deal of history in your field, including the activities of your contemporaries, like Dr. Robert Gallo, J. Craig Ventor, and Thomas Monath—agents and agencies fundamentally stewarded by George Soros and David Rockefeller through the Rockefeller Foundation and revolving doors to the NIH, IoM, NCI, PHS, CDC, NIAID, FDA and even CIA particularly responsible for “biopreparedness” for “national security” and the forthcoming mass vaccination tragedy.

 

 

FORT DIX and RUSSIAN OUTBREAKS

 

I trust your findings and analysis of your 2003 and 2004 isolates and the others you recollect. I concur with your conclusion that anyone with any reasonable intelligence believes these recombinations are possible in nature, and in labs.

 

But you are no stranger to PROBABILITY statistics. So why do you curiously disregard the extraordinarily high probability that the 2009 pandemic flu virus (said to be spreading and endangering billions of people) was not “seeded” like you wrote of the Marburg outbreak in Angola associated with a vaccine program, or the  “laboratory sourced” 1977 flu in America, followed by another one in Russia, both surmised by Zimmer and Burke to be “laboratory sourced” following the 1976 Fort Dix “experiment” to best explain the evidence? (See: New England Journal of Medicine; July 16, 2009;Vol.361:279-285)

 

It is stunning to me, based simply on reasoned probability analysis and common sense, how you, so obviously genius in your analysis of genetic sequencing and gene-swapping, can form such an unreasonable conclusion concerning the origin of S-OIV. You advance and defend the ridiculously remote possibility this S-OIV pandemic is serendipitous, I say conveniently synchronous, with the Novavax/Novartis/SmithKelin/Baxter/CSL corporate capacity to prepare these novel vaccines just in time for this year’s flu season.

 

Evidencing mental scotoma, you write, “The only other known significant transmission was in 1976 at Fort Dix, where swine H1N1 jumped to humans and killed one soldier and infected about 200 more. However, that swine H1N1 (which was classical swine) never got out of Fort Dix and that vaccine program was justifiably criticized because by the time the vaccine was ready, the virus was gone.”[Emphasis added.]

 

The emphasized words evidence grossly negligent analysis. I view this incongruence as TOTAL MADNESS, diagnostic, or symptomatic, of deadly Manchurian candidacy in health science. WHERE WAS THE SWINE? How did its “classical” virus JUMP species?

 

Military personnel have been used for more than a century for drug, vaccine, chemical, and biological warfare experiments. Referencing the “Fort Dix” outbreak so casually as “where swine H1N1 jumped to humans . . .” is tragically remiss. In my humble opinion, it aids and abets an accelerating genocide.

 

There were no pigs at Fort Dix besides the human swine that would experiment on honorable service men and women defending America’s freedom. No pigs at all. Authorities interviewed the infected military personnel to determine if any had contacted any pigs prior to returning to base. None had.

 

This factual epidemiological analysis strongly suggesting military experimentation lends further support for the conclusion reached by Zimmer and Burke that the following year’s swine flu was “laboratory sourced.”

 

In fact, Zimmer and Burke virtually condemned the vaccine program of 1977, not for the lame reason you give, neglecting the resulting injuries and deaths. For all you and I know, that 1977 vaccine, manufactured by Merck that demanded and gained federal indemnification against vaccination injuries and deaths, would have used the Fort Dix strain that was isolated, cloned, tested, then shipped to Russia (as per NCI documents). There it was loosed either accidentally, or more likely intentionally, to drive vaccine markets in the Soviet Union.

 

Here is Zimmer and Burke’s writing that additionally explains WHY Fort Dix was chosen for such military experimentation:

 

“Because of careful characterization of the soldiers and the nature of basic training, the outbreak at Fort Dix provided an ideal setting for investigation and modeling of the epidemic events.(28) . . . Once the virus saturated the tight social-contact structure of the military training base, its transmission potential was insufficient to ignite a larger epidemic in the civilian population at large. The emergence of swine influenza at Fort Dix led to the implementation of a mass vaccination program, which resulted in 40 million civilian vaccinations and 532 cases of the Guillain–Barré syndrome (a rare side effect of influenza vaccination), including 32 deaths.(29)”

 

(Please note that the latter allegation of only 532 cases of Guillain-Barre syndrome, including 32 deaths, is tragically false, as these figures, at that time, were substantially underreported. This allegation is based on the fact that the CDCs own admissions, during the 1990s, attest to less than 10% of vaccine injuries being reported at that time due to lacking surveillance and reporting systems for adequate adverse event data collection. In 1977, it was far more grossly negligent.)

 

Dr. David Sencer, director of CDC from 1966 to 1977, was the man pushing the 1976 swine flu vaccination program like Dr. Anthony Fauci is doing today. Did you know that Dr. Sencer approved of the continuation of the Tuskeegee Syphilis Study in 1969? Did you know that Dr. Sencer was repositioned in New York City at the time AIDS was outbreaking to facilitate media propaganda on behalf of Rockefeller associated blood bankers’ refusal to test American Red Cross blood supplies for contamination; tragically exploding AIDS globally? Did you know that Dr. Fauci, today’s “AIDS czar” for America and Director of the NIAID, on Oprah the other day with Dr. Oz, has conflicting interests in vaccine markets being the co-patent holder on interleuken-2 adjuvant?

 

Although these historic details extend beyond your purview, they are most relevant to urgent matters of faith and trust in those preparing vaccines, influencing media, and directing the “public health” and public’s response to S-OIV.

 

 

H1N1 REEMERGENCE IN HUMANS IN 1977

 

Zimmer and Burke continued:

 

“Even though human influenza A (H1N1) virus had not circulated since 1957 and the swine influenza A (H1N1) virus that had been identified at Fort Dix did not extend outside the base, in November 1977, the H1N1 strain reemerged in the former Soviet Union, Hong Kong, and northeastern China. . . . Careful study of the genetic origin of the virus showed that it was closely related to a 1950 strain but dissimilar to influenza A (H1N1) strains from both 1947 and 1957. This finding suggested that the 1977 outbreak strain had been preserved since 1950. [In a laboratory refrigerator, compelling them to admit. . . .]  The reemergence was probably an accidental release from a laboratory source . . .”

 

Dr. Niman, you propose that the first cases of H1N1 2009 were “not linked to swine or each other. They also were not linked to earlier cases in Mexico, because the virus rapidly spread and had infected many humans in Mexico and the US via H2H [human-to-human] transmission.”

 

Your writing is devoid of epidemiological evidence and reasoned analysis. Thus, it is unrealistic and unscientific. It is a ridiculous speculation, harmful to the public given its flagrant omissions, especially since it comes from you--a respected “expert” in “predicting the changes in . . . pandemic influenza,” as you claim.

 

Dr. Niman, were you sent two S-OIV’s from two places in S. Calif, allegedly coming from two children living about 100 miles apart who had never met, and a whole slew of Mexican S-OIV’s, for analysis too? Probably not. But you assertively argue, “there is NO evidence for human intervention.” Obviously, if someone from CDC or WHO sent you virus samples, clones of S-OIV, then there is “evidence for human intervention.” If no one sent you anything, how can you trust anyone involved? How can you be certain they are trustworthy?

 

As though repeating the same lame argument is going to sufficiently persuade me, and others like me, to make the leap of faith to get vaccinated, you write:

 

“Reassortment, especially in swine, is quite common and quite natural. On rare occasions, flu can jump species and transmit efficiently to its new host as happened in 1918 and 2009, which is why there is an intense effort to generate protective vaccines, like those that have recently shipped after going through clinical trials in multiple countries (China, Australia, US, etc) and are made using the same formula as seasonal flu (a split vaccine grown in eggs, killed, and infected with NO adjuvents).”

 

I have several problems with this quote.

 

 

THE 1918 SPANISH FLU VIRUS

 

First, are you aware the 1918 Spanish flu virus was exhumed by the least trustworthy agents and agencies in America involving the vaccine industry? The Defense Department directed this contract, meaning it was a covert operation for potential biological weapons applications. Dr. Maurice Hilleman, the vaccine chief at the Merck drug company directed the secret discovery according to the New York Times. His living testimony of having brought the AIDS virus into North America in contaminated monkeys (really chimpanzees) destined for vaccine research and development at Merck during the early 1970s now broadcasts on YouTube. Leading the national publicity campaign to persuade the scientific community to accept the risk of reactivating that virus was geneticist Dr. Joshua Lederberg, Counsel on Foreign Relations (i.e., David Rockefeller) Bioterrorism Study Group Director, Nobel laureate, president emeritus of Rockefeller University, and Director of the American Type Culture Collection (ATCC) that shipped Sadam Hussein’s regime anthrax, West Nile virus, and other agents of potential mass destruction as determined by Don Riegle’s Congressional investigating committee looking into squalene adjuvant and Gulf War Syndrome.

 

Second, are you aware of the World Health Organization’s “Safety of pandemic vaccines” report (Aug. 6, 2009)? It states, “. . . some manufacturers have conducted advance studies using a so-called “mock-up” vaccine. Mock-up vaccines contain an active ingredient for an influenza virus that has not circulated recently in human populations and thus mimics the novelty of a pandemic virus. Such advance studies can greatly expedite regulatory approval.” [Emphasis added.]

 

This reveals the industry’s intention to expose populations to new genetic sequences from old immunogenically-active or “live” laboratory engineered “mock up files.” So obviously your allegation these vaccines are “killed” and thus, “safe,” dishonors your credibility and my intelligence.

 

Third, as mentioned, Baxter’s patent claims to be producing its vaccine in VERO cell cultures, not in eggs, raising concerns about SV40 contaminations linked to pandemic cancers and possibly AIDS that, as I previously reported in Medical Hypotheses, incriminates the Merck drug company for both Salk and Sabin contaminated polio vaccines, and the Krugman/Szmuness/Hilleman hepatitis B vaccines.

 

Forth, CHIRON’s MF59  and SmithKlein’s ASOs(2-4) are heralded in vaccine makers’ propaganda as though they expect to use them, including their many toxic ingredients. Just because Anthony Fauci (NIAID Director) claims “No adjuvants” will be used American vaccines, his conflicting interests preclude me from trusting him and those for whom he works.

 

 

TRUSTWORHTYNESS OF H1N1 VACCINE “SCIENCE”

 

Read the vaccine manufacturing patents and they refer to the use of adjuvants. Given the negative publicity squalene and other adjuvants have received in recent years since Gulf War Sydrome was linked to this “oil in water,” it would not surprise me that adjuvant inclusions would be conveniently neglected in package inserts that, by the way, make no mention, whatsoever, of any active ingredients, stabilizers, or sterilizers. It seems the only place people can get a full list of flu vaccine ingredients is by researching the various companies’ patents or secondary sources—mostly vaccine activist organizations.

 

And contrary to claims of vaccine safety and efficacy for general populations, contemporary study designs are highly questionable, or downright dishonest. For example, CSL’s new package insert presents no efficacy science in flu prevention, nor respectable safety study design. (Their placebo for the “active control” group was a “European-licensed trivalent inactivated influenza vaccine” rather than harmless saline solution. And further, their controls received active vaccines with either no preservatives, or multi-dose formulations containing Thimerosal mercury.) Differences between experimental and control groups were, thus, grossly precluded.

 

You acknowledge Australia’s contribution to vaccine safety testing. I wonder if you know that the CSL Vaccine (Afluria) tested in Australia during the past several weeks in pregnant women, as been promoted by American officials despite containing neurotoxic mercury? Many legitimate scientists have linked skyrocketing rates of neuro-developmental and behavioral disorders in children to Thimerosal mercury. These vaccines are being tested on impoverished pregnant women, infants, and children in clinics administered by Rupert Murdoch’s mother, Elisabeth, the Dame Commander of the Order of the British Empire, and Murdoch’s daughter-in-law, Sarah.

 

Now besides these stunning ties to media mogul, Rupert Murdoch, and issues of gross conflicting interests this revelation raises, what really irks me is the abuse of pregnant women that throughout the history of medicine have always been responsibly treated most sensitively avoiding “elective procedures” that have historically included vaccinations. It is unconscionable that neurotoxic mercury would be injected into these women intoxicating extra-sensitive fetal neurology.

 

Moreover, 2009 pandemic flu vaccines are being heavily promoted for pregnant women by Anthony Fauci and other officials on mainstream media. Here is what the actual package insert for Novartis’s FLUVARIN has to say:

 

8.1 Pregnancy

Pregnancy Category C: Animal reproduction studies have not been conducted  with Influenza A (H1N1) 2009 Monovalent Vaccine or FLUVIRIN.  It is also not known whether Influenza A (H1N1) 2009 Monovalent Vaccine or FLUVIRIN can cause fetal harm when administered to a pregnant woman or can affect reproduction capacity.  Influenza A (H1N1) 2009 Monovalent Vaccine should be given to a pregnant woman only if clearly needed.

 

 

CONCLUSIONS

 

Although you and your peers may find my ignorance in recombinomics annoying and discrediting, I find your naivety and myopia appalling irresponsible given your position of leadership and influence in virology, genetics, “public health” and the vaccine industry.

 

What is MOST TREASONOUS to science in the public’s interest, common sense, and the health and safety of people worldwide, is the obvious government and industry officials’ aversion to these detailed discussions. This aversion to scientific debate is the most obvious clear and present danger of vaccinations. This arrogance (i.e., mental scotoma affliction) shown by those with whom you associate, claiming to be reputable scientists and geneticists, is genocidal. 

 

The inability to engage the greater scientific probability, and discuss these issues openly, respecting their urgency and gravity, demonstrates the most lethal ignorance, criminal negligence, and official genocidal malfeasance in human history.

 

This belief-behavioral inconsistency, allegedly honoring science yet evading most reasonable scientific evidence and discourse, demonstrates the hypocrisy in our professional community that is both deadly and demonic.

 

The intransigent lie that “scientists” and “experts” subscribe to, that “vaccines are safe and effective,” is reminiscent of Hitler’s greatest genocidal weapon--his method of psychosocial control advanced by Third Reich propaganda minister Josef Goebbels who proved, “If you tell a lie long enough, eventually it will be believed as truth, and the greater the lie the more people will believe it.”  Vaccines have not been shown to be either safe, or effective, any more than “showers” for “public health” and “disinfection” benefited eugenics targets during WWII.

 

 

Sincerely yours,

 

 

Leonard G. Horowitz

 

 

Dr. Niman Wrote (Sun Oct 04, 2009 6:37 am):

 

Here's the problem with this "debate". The origins of viruses can be traced through phylogenetic anlysis, which is not your area of expertise or knowledge. Scientists can use real data (sequences generated by scientists worldwide) to make a point, which you failed to do, because you can't analyze the real data.

 

Multiple sequences from 1918 have been made public. The location of the isolates is given in the name, so the sequences from Brevig Mission in Alaska are called A/Brevig_Mission/1/18(H1N1) - indicating it was isolated from Brevig Mission, it is sample #1, the sample was from 1918, and the serotype is H1N1.

 

Anyone with internet access can see the history of the sequences. A partial HA sequence was submitted on December 23, 1998 to a public datbase and can be viewed by anyone reading this message by clinking on

 

http://www.ncbi.nlm.nih.gov/nuccore/AF1 ... e_RVDocSum

 

You have not presented ANY evidence that ANY sequences from 1918 are in the swine pandemic sequences of 2009, which are also quite public, because there is no evidence, just statements made by you and others who can't read a sequence.

 

Here is the HA sequence information, including the sequence itself

 

LOCUS AF116575 1220 bp mRNA linear VRL 03-MAR-1999

DEFINITION Influenza A virus (A/Brevig_Mission/1/18(H1N1)) hemagglutinin (HA)

mRNA, partial cds.

ACCESSION AF116575

VERSION AF116575.1 GI:4325017

KEYWORDS .

SOURCE Influenza A virus (A/Brevig Mission/1/1918(H1N1))

ORGANISM Influenza A virus (A/Brevig Mission/1/1918(H1N1))

Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;

Influenzavirus A.

REFERENCE 1 (bases 1 to 1220)

AUTHORS Reid,A.H., Fanning,T.G., Hultin,J.V. and Taubenberger,J.K.

TITLE Origin and evolution of the 1918 'Spanish' influenza virus

hemagglutinin gene

JOURNAL Proc. Natl. Acad. Sci. U.S.A. 96 (4), 1651-1656 (1999)

PUBMED 9990079

REFERENCE 2 (bases 1 to 1220)

AUTHORS Reid,A.H., Fanning,T.G., Hultin,J.V. and Taubenberger,J.K.

TITLE Direct Submission

JOURNAL Submitted (23-DEC-1998) Cellular Pathology, Division of Molecular

Pathology, Armed Forces Institute of Pathology, 14th St. and Alaska

Ave., N.W., Washington, DC 20306 6000, USA

FEATURES Location/Qualifiers

source 1..1220

/organism="Influenza A virus (A/Brevig

Mission/1/1918(H1N1))"

/mol_type="mRNA"

/strain="A/Brevig_Mission/1/18(H1N1)"

/db_xref="taxon:88776"

gene 1..>1220

/gene="HA"

CDS 1..>1220

/gene="HA"

/codon_start=1

/product="hemagglutinin"

/protein_id="AAD17218.1"

/db_xref="GI:4325018"

/translation="MEARLLVLLCAFAATNADTICIGYHANNSTDTVDTVLEKNVTVT

HSVNLLEDSHNGKLCKLKGIAPLQLGKCNIAGWLLGNPECDLLLTASSWSYIVETSNS

ENGTCYPGDFIDYEELREQLSSVSSFEKFEIFPKTSSWPNHETTKGVTAACSYAGASS

FYRNLLWLTKKGSSYPKLSKSYVNNKGKEVLVLWGVHHPPTGTDQQSLYQNADAYVSV

GSSKYNRRFTPEIAARPKVRDQAGRMNYYWTLLEPGDTITFEATGNLIAPWYAFALNR

GSGSGIITSDAPVHDCNTKCQTPHGAINSSLPFQNIHPVTIGECPKYVRSTKLRMATG

LRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADQKSTQNAIDGI

TNKVNSVIEKMNTQ"

misc_feature 52..1029

/gene="HA"

/note="encodes HA1 domain"

misc_feature 1030..>1220

/gene="HA"

/note="encodes HA2 domain"

ORIGIN

1 atggaggcaa gactactggt cttgttatgt gcatttgcag ctacaaatgc agacacaata

61 tgtataggct accatgcgaa taactcaacc gacactgttg acacagtact cgaaaagaat

121 gtgaccgtga cacactctgt taacctgctc gaagacagcc acaacggaaa actatgtaaa

181 ttaaaaggaa tagccccatt acaattgggg aaatgtaata tcgccggatg gctcttggga

241 aacccggaat gcgatttact gctcacagcg agctcatggt cctatattgt agaaacatcg

301 aactcagaga atggaacatg ttacccagga gatttcatcg actatgaaga actgagggag

361 caattgagct cagtgtcatc gttcgaaaaa ttcgaaatat ttcccaagac aagctcgtgg

421 cccaatcatg aaacaaccaa aggtgtaacg gcagcatgct cctatgcggg agcaagcagt

481 ttttacagaa atttgctgtg gctgacaaag aagggaagct catacccaaa gcttagcaag

541 tcctatgtga acaataaagg gaaagaagtc cttgtactat ggggtgttca tcatccgcct

601 accggtactg atcaacagag tctctatcag aatgcagatg cttatgtctc tgtagggtca

661 tcaaaatata acaggagatt caccccggaa atagcagcga gacccaaagt aagagatcaa

721 gctgggagga tgaactatta ctggacatta ctagaacccg gagacacaat aacatttgag

781 gcaactggaa atctaatagc accatggtat gctttcgcac tgaatagagg ttctggatcc

841 ggtatcatca cttcagacgc accagtgcat gattgtaaca cgaagtgtca aacaccccat

901 ggtgctataa acagcagtct ccctttccag aatatacatc cagtcacaat aggagagtgc

961 ccaaaatacg tcaggagtac caaattgagg atggctacag gactaagaaa cattccatct

1021 attcaatcca ggggtctatt tggagccatt gccggtttta ttgagggggg atggactgga

1081 atgatagatg gatggtatgg ttatcatcat cagaatgaac agggatcagg ctatgcagcg

1141 gatcaaaaaa gcacacaaaa tgccattgac gggattacaa acaaggtgaa ttctgttatc

1201 gagaaaatga acacccaatt

 

 

Here are all eight gene segments

 

1: DQ208311

Reports

Links

Influenza A virus (A/Brevig Mission/1/1918(H1N1)) polymerase PA (PA) mRNA, complete cds

gi|76786708|gb|DQ208311.1|[76786708]

 

 

2: DQ208310

Reports

Links

Influenza A virus (A/Brevig Mission/1/1918(H1N1)) polymerase PB1 (PB1) mRNA, complete cds

gi|76786706|gb|DQ208310.1|[76786706]

 

 

3: DQ208309

Reports

Links

Influenza A virus (A/Brevig Mission/1/1918(H1N1)) polymerase PB2 (PB2) mRNA, complete cds

gi|76786704|gb|DQ208309.1|[76786704]

 

 

4: AY744935

Reports

Links

Influenza A virus (A/Brevig Mission/1/1918(H1N1)) nucleoprotein (np) mRNA, complete cds

gi|55273940|gb|AY744935.1|[55273940]

 

 

5: AY130766

Reports

Links

Influenza A virus (A/Brevig_Mission/1/1918(H1N1)) matrix protein 1 and matrix protein 2 genes, complete cds

gi|23986294|gb|AY130766.1|[23986294]

 

 

6: AF250356

Reports

Links

Influenza A virus (A/Brevig_Mission/1/18(H1N1)) neuraminidase (NA) gene, complete cds

gi|13260556|gb|AF250356.2|AF250356[13260556]

 

 

7: AF333238

Reports

Links

Influenza A virus (A/Brevig_Mission/1/18(H1N1)) nonstructural protein NS1 and nonstructural protein NS2 genes, complete cds

gi|13173347|gb|AF333238.1|AF333238[13173347]

 

 

8: AF116575

Reports

Links

Influenza A virus (A/Brevig_Mission/1/18(H1N1)) hemagglutinin (HA) mRNA, partial cds

gi|4325017|gb|AF116575.1|AF116575[4325017]

 

 

Here are the lastest pandemic sequences.

 

http://www.ncbi.nlm.nih.gov/genomes/FLU/SwineFlu.html

 

Real scientists use real data to draw conclusions.

 

You just did a lot of handwaving, ignored the DATA, and rambled on about conspiracies, and stated falsehoods about the sequences (1918 sequences in 2009 sequences), becasue you have no backgroiund or training in these areas.

 

Thus, you claim that triple reassortants, which have been circulating in swine since the 1990's are man made becasue they have human, avian, and swine genes which is silly, since that is what has been circulating since the 1990's.

 

There are many different combinations in swine and they are not due to countless introductions of man made viruses, hand waving and conspiracy theories notwithstanding.

 

 

Dr. Niman wrote to critics regarding Dr. Gibbs, on Sun Oct 04, 2009 6:54 am:

 

The conspiracies are faith based (no science, just faith) and have nothing to do with religion (other than the fact that religions are also faith based).

 

Gibbs simply is speculating about gaps, which are due to a small swine sequence database. These types of gaps exist for MANY swine sequences, becasue the database is small and surveillence in swine is quite limited.

 

Has Dr Gibbs come up with real DATA (a swine vaccine that matches the pandemic strain). Such a finding would be quite publishable and newsworthy, so I have my doubts that any such data exists.

 

 

Dr. Niman replied on Sun Oct 04, 2009 2:58 pm

 

Please. The Zimmer and Burke piece is little more than saying both are H1N1. There are no sequences from 1918 artificially placed in 2009.

 

If you have data present it (don't misinterpret phylogenetic analysis by others).

 

Try to stay on topic, i.e. the 2009 sequences and vaccine.

 

 

Dr. Horowitz posted the following on Sunday Oct 04, 2009:

 

Dr. Niman, thank you for allowing me to win this “debate” by default.

 

I claim victory based on the following criteria:

 

1)Your dismissal and/or neglect of the science I presented;

2)Your transparent evasion of relevant, even urgent, questions;

3)Your dismissal and/or neglect of the science Dr. Gibbs presented;

4)Your dismissal and/or neglect of the science Zimmer and Burke presented;

5)Your written statements that grossly conflict with published science (e.g., you wrote “there is NO 1918 virus in the pandemic strain, . . . ” whereas Zimmer and Burke wrote, “Influenza A (H1N1) abruptly disappeared from humans in 1957 and was replaced by a new reassortant virus that combined genes from the H1N1 strain and an avian virus. This new influenza A (H2N2) strain contained three new segments from the avian source and maintained the other five segments from the H1N1 strain of 1918 lineage.17 After this pandemic subtype emerged, human influenza A (H1N1) was not detected again until 1977.18 . . . influenza A (H1N1) reemerged in 1977, when for the first time in known interpandemic influenza history, two serotype A viruses began to cocirculate. Although the peak prevalence of this virus alternates with a more often dominant subtype H3N2, it has nevertheless maintained a continual presence during seasonal epidemics.32”

6)Your arrogant, unprofessional, disrespectful and false claim that I am unable to “analyze the real data,” when I delivered to you precise “real data” with scientific references neglected by you, and have extended myself intensely to deliver to you for humanity’s benefit “real data”/facts accepted and published by your peers, despite your blind dismissals and disparaging attacks against my person.

7)Inequity of reasoned rebuttals. I presented nearly a dozen pages with serious scientific questions that potentially, if answered, could save millions of lives, that you neglected entirely to myopically repeat there are no genes from 1918 H1N1 (nor H5N1) in the current pandemic, and then condemned me for referencing and relying upon Zimmer and Burke.

8)Your hypocritical untenable faith in those who feed you money and sequencing data while disparaging others who hold faith in religious perspectives or legitimate “conspiracy theories.” 

 

In essence, you have condemned yourself by your condemnation of me and the rest of the reasonable, rational, intelligent, humble, and loving world that seeks simple answers to urgent questions within your capacity to answer. My goodwill and questions were neglected and defended against, solely justified by your disregard for all other fields of science and rationale, placing your exclusive faith in recombinomics, and demanding others do the same lest they be disparaged by you.

 

Had this “debate” been refereed, you would have, likewise, lost respect for failing to match point with counterpoint.

 

There is no need to respond. I have thrown my pearls before swine flu genocidalists sufficiently here, with you, to realize enough is enough. The popular vote will be counted comparing those suffering the ill effects of vaccinations, having no ears to hear nor eyes to see the forest of reality through the trees of deception, with those who awakened in time to celebrate a safer sustaining paradigm.

 

 

Dr. Horowitz added on Monday, Oct. 5, 2009:

 

Now . . .

 

I was not going to reply again to Dr. Niman's nonsense. He has changed his slippery genetic rantings by suddenly back-tracking, "There are no sequences from 1918 artificially placed in 2009." [Editor’s note: Previously on Oct. 1, Dr. Niman wrote: “No, there is NO 1918 virus in the pandemic strain. The 2009 pandemic strain is from triple reassortant swine viruses that are currently circulating. It is ALL natural.’] Suddenly his key word comes into view, "ARTIFICIALLY." The scam is that there is no way to distinguish ARTIFICALLY vs. NATURALLY circulating pieces of H1N1 if, as he states, the amino acid sequences are the same, or cloned.

 

Dr. Niman, you have been royally refuted! Here is the top expert in the field of 1918 Spanish Flu, Dr. Jeffery K. Taubenberger* and David M. Morens *Armed Forces Institute of Pathology, Rockville, Maryland, USA; and National Institutes of Health, Bethesda, Maryland, USA, who dug the blasted-bug up and wrote about it for the CDC. Here is how they link the current 2009 H1N1 circulating pandemic virus to the 1918 virus. NOTICE THEY WRITE THE 1977 STRAIN RE-EMERGED FROM A "LABORATORY FREEZER!" How "NATURAL" is that Dr. Niman?

 

What will you do for your next slippery trick? Try to tell us that FREEZERS ARE NATURAL using Recombinomics and further abuse of this blog space.

 

In 1918, the cause of human influenza and its links to avian and swine influenza were unknown. Despite clinical and epidemiologic similarities to influenza pandemics of 1889, 1847, and even earlier, many questioned whether such an explosively fatal disease could be influenza at all. That question did not begin to be resolved until the 1930s, when closely related influenza viruses (now known to be H1N1 viruses) were isolated, first from pigs and shortly thereafter from humans. Seroepidemiologic studies soon linked both of these viruses to the 1918 pandemic (8). Subsequent research indicates that descendants of the 1918 virus still persists enzootically in pigs. They probably also circulated continuously in humans, undergoing gradual antigenic drift and causing annual epidemics, until the 1950s. With the appearance of a new H2N2 pandemic strain in 1957 ("Asian flu"), the direct H1N1 viral descendants of the 1918 pandemic strain disappeared from human circulation entirely, although the related lineage persisted enzootically in pigs. But in 1977, human H1N1 viruses suddenly "reemerged" from a laboratory freezer (9). They continue to circulate endemically and epidemically.

Posted Feb. 9, 2010

www.fluscam.com/Swine_SLOP_Recombinomics.html